SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012162 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012162
Domain Number 1 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000593
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 2 Region: 213-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000677
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 3 Region: 62-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000068
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012162   Gene: ENSORLG00000009698   Transcript: ENSORLT00000012163
Sequence length 484
Comment pep:known chromosome:MEDAKA1:14:17863288:17869514:-1 gene:ENSORLG00000009698 transcript:ENSORLT00000012163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HHQHQVAQNSLLPLLNAGADQVDQKPVLPIQIDQKPPVSAAELLKDNVASGTGQRPPVPV
IKKEHKGKTPFVCGYCNKAFRDSYHLRRHESSHTGIKMVPRPKKTAQTAPTMVPMIASMA
RENNGNSSYISTVAGMLSTATTSVSSGTSIMTSPSMGNMQQQNVPKKPAKPVKKNHGCEM
CGKAFRDVYHLNRHKLSHSDEKPFECPICQQRFKRKDRMTYHVRSHDGGVHKPYVCSVCG
KGFSRPDHLSCHVKHVHSSERPFKCQACTSAFATKDRLRSHMIRHEGKVTCSICGKMLSA
AYITSHLKTHGQTNFNSCNKGLSHLFFFLHIIQTHFHTFLPFKLSKFKLLLKSKALNTFS
VDANENCNSSSATPVSVSAPNTSTMNRGNGNNNNNPVTIAAQMNISTNTVNITSPVSLQH
PVTITGPVNIASVNIPASAPMNIAHPVAITTPMPMNIAGPLNIAMRPVDSMPFLSQVLPS
SPPW
Download sequence
Identical sequences H2M180
ENSORLP00000012162 ENSORLP00000012162 8090.ENSORLP00000012162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]