SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012370 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012370
Domain Number 1 Region: 294-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000209
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012370   Gene: ENSORLG00000009859   Transcript: ENSORLT00000012371
Sequence length 409
Comment pep:known chromosome:MEDAKA1:3:22048688:22055146:1 gene:ENSORLG00000009859 transcript:ENSORLT00000012371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSDVCDLTLLPSAPPMPSLPGAVGSCGMSVGSGQWTNLLDLHPGSPYSSLNSHHSLIKQ
EPGWGTADPMEDPHCGLGAFTVHFSGQLTGSGPCRVGAFGEPVSQPRMFPNAAYLPSCMD
SSPLPRNQGYGPLALDSNPGYSHSASHHNPQLSSLSFKHEDTLSPTNNIVNQQYPTLNPM
FGCHNPSESTPNSQTLLLRNYSSDNLYQMASQLECVTWNQMNTLASPTKTGQAASFDSDP
MLVSAQYHIHTHGVFRGLQDIRRVPGVTPPVAKSSEASERRPFVCVYPGCSKRYFKLSHL
QMHGRKHTGEKPYQCDVTECGRRFSRSDQLKRHQRRHTGVKPFQCQTCQRKFSRSDHLKT
HTRTHTGKTSEKPFTCRWSNCQKKFARSDELVRHHSMHQRNLSKLQPAI
Download sequence
Identical sequences H2M1T5
8090.ENSORLP00000012370 ENSORLP00000012370 ENSORLP00000012370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]