SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012485 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012485
Domain Number 1 Region: 568-888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-86
Family p120GAP domain-like 0.0000000000707
Further Details:      
 
Domain Number 2 Region: 192-297
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-26
Family SH2 domain 0.00049
Further Details:      
 
Domain Number 3 Region: 25-119
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-26
Family SH2 domain 0.00047
Further Details:      
 
Domain Number 4 Region: 318-424
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-24
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 446-580
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000966
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 6 Region: 120-193
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000735
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012485   Gene: ENSORLG00000009952   Transcript: ENSORLT00000012486
Sequence length 911
Comment pep:known chromosome:MEDAKA1:9:14491712:14514723:1 gene:ENSORLG00000009952 transcript:ENSORLT00000012486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESDMQDGPECEDDEVLLELSAPPTNQWYHGKLDRTIAEERLRQARNPGSYLIRESDRR
PGSFVLSFLSVTNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSYASCLLKGEKLLLPV
APPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNVRTEEQGLIV
EDLVEEVGREEDPHEGKLWYHGKITKQEAYNLLMTVGQVSSFLVRPSDNTPGDYSLFFRT
NENIQRFKISPTPTNQYMMGGRYYNSVDDIIDHYKKEQIVEGYNLKEPVSVQHQEQVLTD
TVDGREIYNTIRRKTKDAFYKNIVKKGYLLFNKGKGKRWKNLYFILEGNDAQLIYFESEK
RATKPKGLIDLSVCSVYCVHDSLFGRPNCFQIVVQHFSEEQYIFYFAGETPEQAQDWMKC
LQTFCTNLRKTTVNTSNKRLRQVSSLVLYVEEAHKLPVKHFTNPYCNIYLNNVQVAKTHP
REGQNPVFTEEFIFDDLSGEINRFEISLSNKTKKSKEIDILFMRCQLNRLQKGQMIDEWF
PLSSHIPLKGIEPGSLRVRARYSVEKIMPEEEYSDLKEMILQKDFHVIYALAHVCGQDRS
LLASLLLRIFRHEKAEAPLLRTLNDREINMEDEATTLFRATTLASTLMEQYMKATATPFV
LHALKDTILKIMESKQSCELNPSKLEKNDDVNLNLAHLLNILSELVEKIFLAAEILPPTL
RFIYGCLQKSVQRKWPNTTMRTRVVSGFVFLRLICPAILNPRMFNIIDDPPSSTAARTLT
LVAKSVQNLANLVEFGAKEPYMEGVNPFIKCNKQRMIMFLDELGNVPELPETTEHFRTDL
PRDLAALHEVCVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQAQYAMSNSNRTECT
IMSLAAAIQVM
Download sequence
Identical sequences H2M246
ENSORLP00000012485 8090.ENSORLP00000012485 ENSORLP00000012485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]