SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012576 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012576
Domain Number 1 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 474-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 59-165
Classification Level Classification E-value
Superfamily SET domain 0.000000000159
Family Histone lysine methyltransferases 0.031
Further Details:      
 
Domain Number 4 Region: 552-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000572
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012576   Gene: ENSORLG00000010025   Transcript: ENSORLT00000012577
Sequence length 638
Comment pep:novel chromosome:MEDAKA1:11:20033005:20039258:-1 gene:ENSORLG00000010025 transcript:ENSORLT00000012577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLESALGDMSSWREVDFALNCTYIVPDQVSDPSFSLPKAMTSIPRNLSFSYNTDNEVIG
VFSKEYIPQGTRFGPLRGDIYTKDNVPKEANRKYFWRIYSGGKLQHFIDGYDVHKSNWMR
YVNPARSPTEQNTVACQNGRDIYFYTMRPVEPKQELLVWYSKEFSQRLCSQQDQLTHRQK
IRNFLENCQQRKTVQTHASQSKKPSSEGGEEEEECAKRDLNRLAWTTDKEQRADEEKIDV
EMLDRDTPPDTPDDQIMDFSKKVEMKDAETWGVLPPPHIGHRGLGQAYLPEQQLQSASGN
LPLHLHGLYGHREGLVSSYPLYPQSRPLQPSYQFLSPYHYPRLLLPACSPPFPGMLPSRG
ALQYGGYLSADRLPYPPIVPPTLLPMSIPYAPSTQGGLKEQTPNVSPPRGSPATPELSPL
AKPSSHLLTPEPSPSGCEEAMNLSMTKSGTAPRNGPGHKSLPYPLKKQNGKIKYECNICS
KTFGQLSNLKVHLRVHSGERPFQCDLCKKSFTQLAHLQKHHLVHTGEKPHECQVCHKRFS
STSNLKTHLRLHSGEKPYQCKLCNTKFTQYIHLKLHRRLHSSQDRPNRCQRCTQAFFHRF
SLCIHQTSCCPAGPGANPRTSEMVERFDASQEAAALPE
Download sequence
Identical sequences H2M2D4
8090.ENSORLP00000012576 ENSORLP00000012576 ENSORLP00000012576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]