SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012606 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012606
Domain Number 1 Region: 281-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 324-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000387
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012606
Domain Number - Region: 238-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00639
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012606   Gene: ENSORLG00000010050   Transcript: ENSORLT00000012607
Sequence length 445
Comment pep:known chromosome:MEDAKA1:20:16771421:16773372:-1 gene:ENSORLG00000010050 transcript:ENSORLT00000012607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESRLKMLLDAGPQYPTIGVTTFGSSRHHSTGEVTEREVALGINPFADGMGAFKINHSSHD
IGSGQTAFSSQAPGYAAAALGHHHHPTHVGSYSTAAFNSTRDFLFRNRGFGDATGAQHSL
FASGSFAGPHGHSDAAGHLLFPGLHEQAASHASSNVVNSQMRLGFSGDMYGRADQYGHVT
SPRSDHYASTQLHGYGPMNMNMAAHHGAGAFFRYMRQPIKQELICKWIEPEQLTNPKKSC
NKTFSTMHELVTHLTVEHVGGPEQTNHVCYWEDCSREGKPFKAKYKLVNHIRVHTGEKPF
PCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPY
LCKMCDKSYTHPSSLRKHMKVHESTNPGSQPSPAASSGYESSTPPTIVSPSTENQSSSSI
SPAASAVHHTTSHSTLSSNFNEWYV
Download sequence
Identical sequences H2M2G4
8090.ENSORLP00000012606 ENSORLP00000012606 ENSORLP00000012606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]