SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012611 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012611
Domain Number 1 Region: 343-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000059
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012611
Domain Number - Region: 288-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0417
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012611   Gene: ENSORLG00000010055   Transcript: ENSORLT00000012612
Sequence length 533
Comment pep:known chromosome:MEDAKA1:20:16776773:16779809:1 gene:ENSORLG00000010055 transcript:ENSORLT00000012612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDALGSPVMDPTFSKRNTALRLVDLAGAHHHHHHHHHTPQSVTGFPGFSSHPHSMAHS
HPGEITAEPRLGPSPFGPEHMGHSAALKISPAHHYPHHHHHHHNHHMAGHSEVVSSQTGA
FGPVQATSVPYSMSHSAQALSAGRDFLFRRDLTAQAMPVLTDQTAGSASHHGMFVSTTGS
YPGHYGHHPDAGNHTALFPGLHHEQNSSGSPGGQALSGQIRLGLPGEMYVRSDHLSQVAS
SRADPFSASPLHGYGGLNLNMNLSAHHHHHGAGAFFRYMRQPIKQELICKWLEPEHSPKK
LCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEK
PFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDK
PYNCKVRGCDKSYTHPSSLRKHMKVHCKSPPPSSGYESSTPSLVSPSSDLGREPAGSSVL
SEPLGASQSANLSEWYVCQSSGASGAQTPPSGQSTPDHAHDPPYRNPQPRDAF
Download sequence
Identical sequences Q7T1Q8
8090.ENSORLP00000012611 ENSORLP00000012611 ENSORLP00000012611 XP_011487273.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]