SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012650 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000012650
Domain Number - Region: 10-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000627
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 261-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.032
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 153-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0429
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 384-429
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0921
Family Cytochrome c3-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012650   Gene: ENSORLG00000010090   Transcript: ENSORLT00000012651
Sequence length 432
Comment pep:novel chromosome:MEDAKA1:15:23791634:23792929:1 gene:ENSORLG00000010090 transcript:ENSORLT00000012651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQLLVKGQCTVCSKVFFTKAEMEKHTESTQHDVEVNQTVVQALLQYGRFHRAQQEQRRS
FQKRPREEKDRGEDSVKQRRLTPGVHSSSSRTSETAWFCECGLQFPEEGVATKHLLAVNQ
IFHLCGVCSKLMGESSIASLHMSRFHGGAHLSNFLYFCRKCNVEMPRFEDILSHVSDVHR
GHTYIAEQEVPDDLQAKPSTSSEAATSSSGRSKVQQNTVETSSSVARGLTWMCRMCEDVF
DSEVAIRKHCSDISSHSFQRFICGHCPQKFFKESTVRRHCTNEHGGDIKSWYFCGLCDSM
QMDSEAELLEHYRSLHSRDYCCMDDADVLQPAAAMLPLDCPCMSSEGNKETVTGVYTRCM
KELAAEGKCQYVCPPCSVSVPTYAQIKTHVHTKHPSLNLDKTFEVQCNMCHQSYMGVPGF
HKHYHHCHCTLE
Download sequence
Identical sequences H2M2K5
ENSORLP00000012650 8090.ENSORLP00000012650 ENSORLP00000012650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]