SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012684 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012684
Domain Number 1 Region: 449-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-22
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 334-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 187-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.84e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 34-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 548-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 228-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 75-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-16
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 10 Region: 295-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 11 Region: 116-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000467
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 3-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000287
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012684   Gene: ENSORLG00000010117   Transcript: ENSORLT00000012685
Sequence length 603
Comment pep:novel chromosome:MEDAKA1:1:27668600:27691317:1 gene:ENSORLG00000010117 transcript:ENSORLT00000012685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHTGEKPYCCCICGRGFNQKGNLKTHYKVHLGERERPYSCPDCGKRFINESYIQIHQRIH
TGQKPFLCSQCGRGFHTASSLKLHEMRHSGERLFACSLCRKTFRIHSYLTAHYQTHIKDR
PFTCSVCGKGYSRAEELKVHHRLHTGGGPYQCGECGKSFMPEESFTKSDPIDNDKPLHSC
LVCGKDFPYASKLQRHLRTHSGERPFPCSMCEKRFPEKGLLMIHERVHTGEKPFPCTFCE
KRFASQGELRLHRRTHTGERPYHCSICLKSFSRHWHLKTHLEAMHSEIVEGFTRKKFPCS
ECEKSCNSAAELRDHQRTHTGERPFQCSFCDKRFALSGTLVRHERLHTGITPYHCSDCGK
TFAQQWTLTTHMRTHTGEKPYSCTQCDKSFVAPGELRRHVRIHTGEKPYTCADCGRHFSL
AGTLRNHKRSCTHKKTYCCGLCGRDCHKMSALQIHMRIHSGEKPYQCTVCGKQFTQKGQL
KGHFKVHTGEKPFSCPECGKSFAHSGAMNRHRLTHTGERPFHCSVCDRRFNQSGRLREHE
KIHFGEKFDCPECEKSFTRSSSLKNHFRLHTGERPYHCDLCGRGFSRSQSLRLHRRKHQQ
VQS
Download sequence
Identical sequences H2M2N8
ENSORLP00000012684 ENSORLP00000012684 8090.ENSORLP00000012684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]