SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012733 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012733
Domain Number 1 Region: 291-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 347-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012733   Gene: ENSORLG00000010156   Transcript: ENSORLT00000012734
Sequence length 433
Comment pep:novel chromosome:MEDAKA1:5:18846679:18849161:-1 gene:ENSORLG00000010156 transcript:ENSORLT00000012734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAANSGSSMATSASLETVMSCGRTGPAAPPKSLAFSIDRIMAKSVEPRRSTEERTEGKKV
LGLCSPIPCMIPLQPFSYDLQAKALMNYTDLWRASFRGALCGSAPAPCKGGCAMCGKEEP
GLKQPLLAPGSRVVKPQVIHQAVAVPSCGSLYYLNYLDSAYQQSELLAGHWLSGPQAQAS
LSAHHRLLLLENAKLSGVGAEKLPTPQYPHKEHLPGQLDQIVKENQSLSSEKSAVKAHSR
LSGGSGVDGKHKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRH
KIIHTQEKPHKCNQCGKAFNRSSTLNTHVRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTH
SGEKQYKCSICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHIRKLHDNG
FASASEASRELQS
Download sequence
Identical sequences H2M2T6
ENSORLP00000012733 ENSORLP00000012733 8090.ENSORLP00000012733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]