SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012955 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012955
Domain Number 1 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012955   Gene: ENSORLG00000010342   Transcript: ENSORLT00000012956
Sequence length 258
Comment pep:novel chromosome:MEDAKA1:21:7214264:7224911:1 gene:ENSORLG00000010342 transcript:ENSORLT00000012956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTCLELERYLQTEPKRLSELFDEELDCLLTPAFMQGGDSDEDLMDPLLPGLPDQPSPPPL
LVTLPKVQTKLLQVSSPTKNHAVAGVEAVTTKEQALGGVSAVQLSAAVTSLTPPSSPELG
RHLVKPAQTLTANADGTLTLKLVAKKVGLGAAKLVAAEALPSPPSQGGALSDSEQGGSLG
GDVPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTR
HYRKHTGAKPFKCNHCDR
Download sequence
Identical sequences H2M3F1
ENSORLP00000012955 ENSORLP00000012955 8090.ENSORLP00000012955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]