SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012976 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000012976
Domain Number - Region: 443-518
Classification Level Classification E-value
Superfamily RuBisCo, C-terminal domain 0.0152
Family RuBisCo, large subunit, C-terminal domain 0.013
Further Details:      
 
Domain Number - Region: 401-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0193
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012976   Gene: ENSORLG00000010358   Transcript: ENSORLT00000012977
Sequence length 655
Comment pep:novel chromosome:MEDAKA1:1:28022237:28032659:-1 gene:ENSORLG00000010358 transcript:ENSORLT00000012977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRGYGSSYSSWGSGGLGSRGKKYSGGFESYGGGYKDSMSGSGGFGGGSHMKRGISGGS
PLSSGGTHADAVIAKINHRLDMLSQFEGGFKGPRGDGFDQYESFDSRTSALPSRDLYRSG
GSSFGFGDVRGDSMLLNQQGGSTFGGGMGLGGGGGGFDSPSSAYGVAKMRQNMRESFASG
QGGGSGGGGWVGANRRSPRRGGSAGGRGGFGGRRSDPTPLGGGLRGSGSGVQSHGGYSPG
GGRGKLPSLLSNRMYPESGGFQGSAAGPHDFPGRHFGGGPRAGRQRGRKRPLNKLKQQQV
KPQGNFQKKRKNPAEADEPESKMNRKEDEGTETTPEEPEKADDDKAETAADETQPTEGED
VAAPKQEEMTKPHGKQSQGQEKSKNRKRRGFLESICSLRVMFACSVCKFRSFYKADMEVH
LESRFHKEHFKFLSSQLSKPTTDFLQEYLMNKFKKTDERVSQMENHSAAICQMYREQDLT
RELGMEHFMRKVEAAHCSACDVFIPMQPHLIQKHIKSHDHNYNRKGMMEQSKRGCLSVAR
SILNHKLIGKKLESYLKGENPFVGNQDEQDPEDSIANEASEVTSEAAAGQTEVKDEPVPE
EETVKEEMEEVQIEPPAATAADQEEEREGNMEQDGDKELENAEMEGFEVGEDEDE
Download sequence
Identical sequences H2M3H2
ENSORLP00000012976 8090.ENSORLP00000012976 ENSORLP00000012976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]