SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013152 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013152
Domain Number 1 Region: 408-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.54e-28
Family Forkhead DNA-binding domain 0.00001
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013152
Domain Number - Region: 252-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0268
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013152   Gene: ENSORLG00000010494   Transcript: ENSORLT00000013153
Sequence length 656
Comment pep:novel chromosome:MEDAKA1:23:4499132:4536829:-1 gene:ENSORLG00000010494 transcript:ENSORLT00000013153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAMMSPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQVQRPFKEKQKTQTREGSQ
EFYKKQQEQLHLQLLQQQQHPGKQVKERIGTVGRGLVRIVEAVQILPQALPLPALFRYGL
LSLPGPTPGQAALPGQTLPPPGGLSPAELQQLWKDVTGGGGHSMEENGIKHSSGGTGTGT
CVGGGGGGLDLTTSNTSSTTSSSNPAKASPPISHHSLTNGQSPALNHRRERERESSLHEE
NGGTHPLYGHGVCKWPGCENICDDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQL
SKERERLQAMMTHLHMRPSEPKSSPKPLIFINTCSESAGGVSPSPRSFSATPLLSRLHLN
PPHSARRLTIKADICNCLALNFKVSFEPEVTLKFEIAPNYEFYKNADVRPPFTYATLIRQ
AIMDSADMQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTV
DEVEYQKRRSQKITGSPSLVKNLPSSLGYGNALNASLQAALAETSLPLLGNPGLSTLSGS
SPGLLQTGHEELNGTLDHLDTNGHGSPGYSPSAHIFIIVARALSLSEAPDRVPPCLCVTA
LLFLLAARRPSVRVKEEPLNMDDDDCPMSLVTTANHSPELEDDRELEEGNLSEDLE
Download sequence
Identical sequences H2M3Z1
ENSORLP00000013152 ENSORLP00000013152 8090.ENSORLP00000013152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]