SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013194 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013194
Domain Number 1 Region: 30-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000102
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 
Domain Number 2 Region: 239-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000011
Family HkH motif-containing C2H2 finger 0.061
Further Details:      
 
Domain Number 3 Region: 165-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000406
Family HkH motif-containing C2H2 finger 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013194   Gene: ENSORLG00000010525   Transcript: ENSORLT00000013195
Sequence length 397
Comment pep:novel chromosome:MEDAKA1:21:8046991:8056932:-1 gene:ENSORLG00000010525 transcript:ENSORLT00000013195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLFPAGNGGGSTPGLMGATGPSVMMKPFLPFSVETTSPVGLFPNFNTMDPVQKAVINHT
FGVTMVPKRKQIISCNVCQLRFNSDSQAEAHYRGSRHAKKLKSQENKAKAKMTVSTENNG
NSCGTPTPPVLTGNQHTGGFPLVCHSSFCCLKSFYFSISLPELLCSPTDSPTPLKQEASL
SVESEEEKAKKLLYCSLCKVAVNSLSQLEAHNAGSKHKTMLEARNGSGPIKAYPRPGAKL
KSSGSSSSSGPKGSGLQNKTFHCQICDVHVNSEIQLKQHISSRRHKDRVAGKPSKPKYSP
YNKQQRTSINVSGNPTRLFSRCMRIQTSHISPDPPVSFFLPTCVFSILIWPYPLLLNISI
SDTTTFPPPAPLFTASFLRPAPGPIRASQGSILFAPY
Download sequence
Identical sequences H2M433
8090.ENSORLP00000013194 ENSORLP00000013194 ENSORLP00000013194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]