SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013198 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013198
Domain Number 1 Region: 56-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000014
Family HkH motif-containing C2H2 finger 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013198   Gene: ENSORLG00000010530   Transcript: ENSORLT00000013199
Sequence length 113
Comment pep:novel chromosome:MEDAKA1:21:8080654:8081278:-1 gene:ENSORLG00000010530 transcript:ENSORLT00000013199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFFSVMKTPLGPSQLLESGQILAFGGMCQEILNTSRAHALSVQKTSSPGQGGAYSLCEV
CNLQLTSASQAQLHYNGRSHLRRVRQLQAGETGQQTAGLSPTPGPSPGLLSPG
Download sequence
Identical sequences H2M437
8090.ENSORLP00000013198 ENSORLP00000013198 ENSORLP00000013198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]