SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013385 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013385
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily POZ domain 2.83e-22
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 332-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-19
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000313
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013385   Gene: ENSORLG00000010678   Transcript: ENSORLT00000013386
Sequence length 444
Comment pep:novel chromosome:MEDAKA1:16:16130342:16131759:1 gene:ENSORLG00000010678 transcript:ENSORLT00000013386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGEDGLIGIPFPEHSNELLSHLNDQRRTGILCDLTLTSRGARYPTHRSVMAAVSLYFR
GLFGAEEAGGEVGGGFSVCQLDCVAPDALDALLEFAYTATLTIPSSGMRDVLRGAQLLGI
QCVADACRDILGETAEAEGEKTEEQRIPDQVTGTIMKEEISIKKVSRRKTDKRMVKKIGS
NHINSSPIRSLAASPASHPSPVSDNFRSLPSTQPPSPEQEELHCKPRQNGNPRVFGGLGR
RATANGSVRHWHQERPPIAHAAPVQSLSDKLSEDDEMGSLGDDVLRMETSSMTTSLADPG
AASSPAGMGRKRKSQTPQQCPVCQKIIHGAGKLPRHMRTHTGEKPFQCTTCGVRFTRNDK
LKIHMRKHTGERPYPCPHCPARFLHSYDLKNHLSLHSGARPFECPLCHKAFAREDHLQRH
RKGQSCLELRTRRPRRGPEQDEDG
Download sequence
Identical sequences H2M4L7
8090.ENSORLP00000013385 ENSORLP00000013385 ENSORLP00000013385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]