SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013400 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013400
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-22
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013400   Gene: ENSORLG00000010690   Transcript: ENSORLT00000013401
Sequence length 131
Comment pep:novel chromosome:MEDAKA1:9:16281671:16283699:-1 gene:ENSORLG00000010690 transcript:ENSORLT00000013401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVVGRQASPEKRHCCPFDGCGKVYGKSSHLKAHLRVHTGERPFKCTWPDCGKKFSRSDEL
TRHFRTHTGEKRFTCPLCDKCFMRSDHLTKHARRHAGFHPSMLQGPSVAKRRRCSVSMSS
SDSGDQSPSGV
Download sequence
Identical sequences H2M4N1
8090.ENSORLP00000013400 ENSORLP00000013400 ENSORLP00000013400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]