SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013456 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013456
Domain Number 1 Region: 177-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000149
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 215-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000938
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013456   Gene: ENSORLG00000010734   Transcript: ENSORLT00000013457
Sequence length 270
Comment pep:novel chromosome:MEDAKA1:22:2320668:2323615:-1 gene:ENSORLG00000010734 transcript:ENSORLT00000013457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKTLPAPVPLHPSLQLANCSLIQSSTGLQLPADHFHSIYSFSALHAIHLHQWTLGYQP
LALPRCTISKLPPQFSSMASIPIFPHLLQPKLDSAALLQSSKSKPRFDFANLAAAATQDD
HLKVEDLSMTGAAAAATAQVPPQHQSSSGLGCLLDVTKLSSPERKSSRGRLPSKTKKEFV
CKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQEC
GKGFCQSRTLAVHKTLHMQVKELKPAKVNC
Download sequence
Identical sequences H2M4T5
ENSORLP00000013456 8090.ENSORLP00000013456 ENSORLP00000013456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]