SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013943 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013943
Domain Number 1 Region: 286-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 329-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000588
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013943
Domain Number - Region: 244-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0103
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013943   Gene: ENSORLG00000011117   Transcript: ENSORLT00000013944
Sequence length 449
Comment pep:novel chromosome:MEDAKA1:21:9245812:9248089:-1 gene:ENSORLG00000011117 transcript:ENSORLT00000013944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITASDIMLLDAGHQFAGLGVGSFARHHSASEMQDRDLSLAQNSFVDSAHMGAFKLNHDLS
PGQSSAFTSQAPGYPAAALGAHAAHVTSYASSPFNSTRDFLFRSRGFGESSPASSQHTIF
GPTAGSLHHSHTDTQGHILFPGIHDQHGSHASPNVLNGQMRLGLPGEVFGRSEQYHQVSS
PRTDPYSAAQLHNQYGSMNMNMGMNMAAHHHPGAFFRYMRQQCIKQELICKWIDPDQLSN
PKKCCNKTFSTMHELVTHVSVEHVGGPEQTNHVCFWEDCSRESKPFKAKYKLVNHIRVHT
GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHT
SDKPYLCKMCDKSYTHPSSLRKHMKVHESSPSASDSSPAASSGYESSTPPGLVSPTTETQ
SNTTLSPASAVHNTTSHSGLSSNFSEWYV
Download sequence
Identical sequences H2M653
ENSORLP00000013943 8090.ENSORLP00000013943 ENSORLP00000013943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]