SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013953 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013953
Domain Number 1 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 372-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000484
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013953
Domain Number - Region: 257-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0108
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013953   Gene: ENSORLG00000011124   Transcript: ENSORLT00000013954
Sequence length 502
Comment pep:known chromosome:MEDAKA1:21:9252145:9254638:1 gene:ENSORLG00000011124 transcript:ENSORLT00000013954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFADGLVCVVMEPPLSKRNPAIRLADLAATQPLPHQNMTGFPGLGGHHPLSHHAHLHPGE
LGNDPGVALTPFGPEHMAQTNALKLSPSQHIQSHPEAQTAASFTSAQTTVGFPVAHPHSG
YSSSRDFILRRELSASAMHALGDQHSSASSPHHHGMFISPTGAYGHAESGAHSLFTGLHD
QASPGAHHALNGQMRLGIPGDVYGRPEHFGHRPEHYGPSSLHSYNSMNLNVNIASAPHAA
AGAFLRYMRQPIKQELICKWIDQELSQKKPCSKTYSTMHELVNHVTVEHVGGPEQSSHVC
FWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKP
FKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSPP
PPSTNVPYISSTNPLGDPLSPNPDPHRNRSANLSPQVTNLNEWYVCQGSGGPNHLHTPSS
DMPTSDSEEEDSFRNSDPRTML
Download sequence
Identical sequences H2M663
ENSORLP00000013953 ENSORLP00000013953 8090.ENSORLP00000013953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]