SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013994 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013994
Domain Number 1 Region: 116-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.67e-23
Family BAR domain 0.022
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-17
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Domain Number 3 Region: 458-527
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-16
Family SH3-domain 0.00072
Further Details:      
 
Domain Number 4 Region: 356-426
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000341
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013994   Gene: ENSORLG00000011154   Transcript: ENSORLT00000013995
Sequence length 528
Comment pep:novel chromosome:MEDAKA1:10:25039422:25051181:1 gene:ENSORLG00000011154 transcript:ENSORLT00000013995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRDPCSVCACSPEVNASSLSFFLVMPVQRIARYPLLLQTIQKHTDPSHPACALLDKTAH
TSVALNCRINEYKRFREVADKYKKTENLTIRDKIVRLNTHSIAKKTARFSQHIKHETGMA
PKVVDEEFDALEGFFAVLDHGILQLLENVETYLFNLQGFLECRTEEFDFDMEGEKSAVSY
KEITTALRQWVLPTFEKRMRTLIHKPLCALRDLLVGPRNLIKKRFHKLLDYEVIEGKASL
SFEEQEVVNTYKTLNTLLLNELPRFNGVALQMIWSMLGTFSCLHKDLTADMEQLFQSFAQ
QLPHSFLSHGAFWEWAESAVLDGARSLHALCQTVEETLSVPVVQPLSPTSHRRLQQLTGK
HGSGKIYQVTSSVVGSRDLDLSLAKGELVAVISGADTRGDKRRWLVDAGGRRGYVASSKL
IRYHQAAEDPPPSPHPGLPETVSGNRRYSYSPGPPAHTSQPCFQTLNTEVLAAYNFTARG
NHEVSLQAGRPVRVLEPHDKRGNPEWSLVEVASGQRGYVPSNYLTLIP
Download sequence
Identical sequences H2M6A4
ENSORLP00000013994 ENSORLP00000013994 8090.ENSORLP00000013994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]