SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014019 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014019
Domain Number 1 Region: 736-784
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000314
Family Myb/SANT domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014019
Domain Number - Region: 861-890
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00259
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014019   Gene: ENSORLG00000011175   Transcript: ENSORLT00000014020
Sequence length 906
Comment pep:novel chromosome:MEDAKA1:22:4108323:4130739:-1 gene:ENSORLG00000011175 transcript:ENSORLT00000014020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQQKPNGKRTGKRITFFSDQTVAMKETSQHPDGVFYVPSGTSSDPGQSEAASTVTSNPEG
PHVFLNSVIFSPDKGDQSRGHYQQTVPMKWAHQEPSQQQPSLSQQQRATTWASMPNWGQS
FANYLGGLNVTEARTQNAFVKSMHETSGLPASNRASEKPAADVYRDAAKPRGMEWEQQAF
QETLKPGVLNTQQQGPPHPGGSSVLQPFQLAFGQPKQHLPPYYQTFQGTRAALPNPPNYS
GQNAVPSHRHVIQQQIQHHQQMQQQQNPHVLDFYSGAQNAPPELQPVVVHSQESSAPAAP
KAQEPIIQDITPEPQQPSHPPQHPLQPDLPSHPQTQLQSQSQPRRSRRLSKEGGEPSDNP
FLPVSSEQIKSENGALQAAPTGVIQSTRRKRRMSQEVNLEMLAQEALDRPWSPTNTEGMN
TKCPRDDNLLPLVIPVSVPVLKQEPSSPGHDEAALAPSWTHGPANPQELGRRDHKPSVIV
TRRRSLRNSLSEGNDGLEGEKDDDGKKSKRRPRPDPLFIPPPKLIAPPVYSSITSYQSHL
RSPVRLTDNPVTMPPYTPPPILSPVREGSGLYFSTFLSSVAASSGGLPPPATPKSATRSL
LRTSSCDITPPVLSAMSEATPVSIEPRINIGSRYQAEIPELRLRSDAELDQHRAELVWAP
LSALEEKPDFKQKVEDLMHLACSSVLFGGGTNQELAHHCLHQCEGDIMAALSMLLLKNPI
FPRSHHLSRYHYSGSDSWTAAERRQFNKGIGTYKKDFFMVQKQVTTKTVAQCVEFYYSFK
KQVKIGRSGTLVYGVSEPPESRTTAEELDLKNTAKSQEHVARDQPLSRVIHPSPLNAKPR
YDVTPRRSSPSAGNQVLAGQEGEFPCKKCGRVFYKVKSRSAHMKSHAEQEKKAAALRQKE
AEERAA
Download sequence
Identical sequences H2M6C8
8090.ENSORLP00000014019 ENSORLP00000014019 ENSORLP00000014019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]