SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014034 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014034
Domain Number 1 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 632-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 710-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 492-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000513
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 5 Region: 304-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000276
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 556-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000822
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014034
Domain Number - Region: 467-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00244
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 42-153
Classification Level Classification E-value
Superfamily SET domain 0.00392
Family Histone lysine methyltransferases 0.037
Further Details:      
 
Domain Number - Region: 379-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00708
Family Classic zinc finger, C2H2 0.074
Further Details:      
 
Domain Number - Region: 191-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00874
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014034   Gene: ENSORLG00000011187   Transcript: ENSORLT00000014035
Sequence length 768
Comment pep:novel chromosome:MEDAKA1:19:15106810:15110975:1 gene:ENSORLG00000011187 transcript:ENSORLT00000014035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEECLTLFQNQSDPNNINGPSFILDFSTSMGTQQRALLTLPYGLMIGRSSIPSAGIGVIN
HGPEVSPGMHFGPYEGEVTTKENAITSAFSWEIHKDEDHYEYIDATNDLYSNWMRYITFA
RSKEETNLLAVQYNGSILYHCCRTIHTGDELTVWPSNQLLSHFSKAWTQMWLSKLNAAEN
NASTTSSIFPCSGCHLSFTTESFLQRHTENFHNQPKVIEAANTSSKEAQAVRPLQQAAVL
LPALQEELQKQIPVKAQNGGEVMCESSTPNADDSEKTKDVVAAEGLEKDAQVLDPAASEA
ADPDHFACSDCSSSFTNEADFKKHRVSAHEKLRPYVCSVCQKCFVQYHDLNRHLRCHRKK
MEKKDKAKAHPECPPPMPFSCAKCLTSFDSVDALQQHINKLHSGEEDVSLHAEPVQKDSC
PRPQRLAARSKVSAVTKLVAPKRKAASPTKTEKSSEADGASKAKIQRWFSCNHCKQTYTK
PDDLKAHKCSLKPLKCGQCGATFLKSGFLRRHELVVHLKAKSYSCERCSRDFSTAGKLKQ
HQKNNSCLKYHCAAEHYPCPYCQFSFTLKSYLNKHIKRHHPVEFLSLCEQGAPIVQLEEK
EAEPVCKHCGIDFGTTKELKSHQCLKQVKVLYLCTDCGKSFTNHYSLKQHQRIHTGEKPF
SCTQCSKSFSYVGQLNVHLRTHTGEKPYLCTHCGDSFRQSGDLKRHERKHTGVKPYSCTE
CSKSFSRPQSLKAHQLLHLGQRMFKCSQCGKSFSRNYHLRRHVQKMHM
Download sequence
Identical sequences H2M6E0
ENSORLP00000014034 8090.ENSORLP00000014034 ENSORLP00000014034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]