SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014330 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014330
Domain Number 1 Region: 28-134
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 460-560
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 3 Region: 569-684
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 4 Region: 325-444
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014330   Gene: ENSORLG00000011443   Transcript: ENSORLT00000014331
Sequence length 905
Comment pep:novel chromosome:MEDAKA1:1:31038547:31058258:1 gene:ENSORLG00000011443 transcript:ENSORLT00000014331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSHSFLSAFLYLLMLSPPRLSAQEVLVRLAGEGRRGDNEGRVEVFYQGSWGTVCDDEVD
INLANVLCRQLGFQRSFTWAHSAKFGRGQGMIWLDNVRCKGTELSVAQCHSNGWGVNDCT
HAEDLGVICSPERRARAPAVTVDQVSSSNRQERQRIPQPAPHPAPPGASIQPLSRRGHEI
ALHRTPTSSRRSQLSPQENGHEIQILRRHHGSGRSNQQPSQSLPQGHQLPSRLANGATFR
PRQETVEGSPQAVRQAEEHPQREPHSQLQSERREDQHQQLSGNHVEPDPIHPDLGLETEP
QGTEESERGHLVEVRIHPVLSNYRGGLVTEGVVEVKHSGKWRHVCDHGWDLSSSRVACGM
LGFPAAEAFDKPAYRKLWESKLADPSSGIRTQIQKKSYWVEKVRCQGVEASLSQCHSQLS
LPRSEVPCRGGMHAVVRCVPGHQFSYQSRTPAPPAVSPVVRLKAGARLGEGRVEVLKEGK
WGTVCDHLWDLSAASVVCRELGFGTAKEALTRAQLGQGTGLIHMNSVQCTGRERSLTDCP
HRPVPLYSCKHSQDVAVRCNVPDSGLQATVRLSGGRDPGEGRVEVLMEVRGAKRWGSICS
ENWGINEAMVVCRQLGLGFAARAHQETWFWPGSPEASEVVLSGTHCTGTEMSIQQCRRNG
QVYCPRGGDGRAAGVTCVETAPDLVVDAQLVQESAYVEDRPLHLLVCANEENCLSSSAAR
MNWPYGHRRLLRFSSRIMNMGRADFRPRASRESWTWHQCHRHYHSIEVFTHYDLLTLNGT
KVAEGHKASFCLEDTYCPEGLHKRFSCYNMGEQGISVGCWDTYRHDIDCQWIDITDVRPG
EYIFQVEVNPTLDMAESDFQNNAMRCRCKYDGARVYVYGCHSGDAYSAEVEDLFDHQRQI
SSNFL
Download sequence
Identical sequences H2M777
8090.ENSORLP00000014330 ENSORLP00000014330 ENSORLP00000014330 XP_004066182.1.28442 XP_011477152.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]