SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014500 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014500
Domain Number 1 Region: 43-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000874
Family HkH motif-containing C2H2 finger 0.039
Further Details:      
 
Domain Number 2 Region: 118-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000504
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 
Domain Number 3 Region: 209-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000218
Family Classic zinc finger, C2H2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014500   Gene: ENSORLG00000011575   Transcript: ENSORLT00000014501
Sequence length 265
Comment pep:novel chromosome:MEDAKA1:4:19466806:19473512:-1 gene:ENSORLG00000011575 transcript:ENSORLT00000014501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIPAPVSRPACGPPPAQAAPPSELDIDEGSSVGMEEQEDSMGLEELCKPLYCKLCNVTLN
SAQQAQAHYQGKNHSKKLRNFYAGSKQPPAIRIPEALEVSWPQGLYKGAPRVILATENDY
CKLCDASFSSLAVAQAHYQGKNHAKRLRLAEAQQNSNNIESSTETVPRRNRKDGSEYRLV
KNRRSPQMAATMQVSPGPYYNPRPRQRIPRDLAMCVTPSGQFYCSMCNCGAEQETDFRQH
LESKQHKAKVSELRYRNEMENLGYS
Download sequence
Identical sequences H2M7P2
8090.ENSORLP00000014500 ENSORLP00000014500 ENSORLP00000014500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]