SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014542 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014542
Domain Number 1 Region: 463-915
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-44
Family Hermes transposase-like 0.007
Further Details:      
 
Domain Number 2 Region: 31-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000143
Family BED zinc finger 0.057
Further Details:      
 
Domain Number 3 Region: 203-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000069
Family BED zinc finger 0.038
Further Details:      
 
Domain Number 4 Region: 303-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000105
Family Classic zinc finger, C2H2 0.073
Further Details:      
 
Domain Number 5 Region: 397-455
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.0000432
Family Hermes dimerisation domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014542   Gene: ENSORLG00000011603   Transcript: ENSORLT00000014543
Sequence length 920
Comment pep:novel chromosome:MEDAKA1:23:6824394:6827156:-1 gene:ENSORLG00000011603 transcript:ENSORLT00000014543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSIENNVEELSDGGSERLPGTPKGSNSRRRSAVWKHFYLSPADNSKAVCIHCMNEFSRGK
NGKDLGTSCLIRHMWRAHKEVVIEENGQGNHIPPPYTNPPSLLSRTQLLDSFEVKKESPL
LPSSPETIADELPQSIEESMDIKEECEEVMQFSGQESSLNFFKAQEEDTPLTSSPCELFD
GPGLSQDHSVFQQNKKIMKRVKSEVWHHFIVSPVDQLKALCRYCPCVISRGKRGDFGTSC
LMRHLTRRHPDVLKNQKSTDEKESPPHPYNNLATTDTVSAKETEVPVTEAKAQPVPAFSK
KTSKLWNHFSISPADPTKVVCLHCNRTISRGKKTTNLGTSCLFRHMQRFHGHVLESNNAI
SGDAQDAEIHVKQEVMETSVYETEQNCERFDEEHPVAKKITKLVAEMLALDLQPSAVVEN
AGLNRLLEYLKPQYSLPPSSYFTSTAIPDMYEKVKDVVLTHLKEAEGGVVHFTTSIWVSS
QTREYLTLTAHWATYESSVRPQGQDFHCSALLSVSQIDCDQDMHDIPKQLEYLWDSWITS
SGLKRGFTLTDNITIQHTLEEHGHPIMECFGHTIDLIVSEAIKSQRMVQNLLSIARKICE
RVHRSAKAKEKLVELQRAHQLPENQLVQDVPSKWRTSFFMLERLVEQKNAIDEMSIECNF
REIISCDQWEVMLSVCNALKPFEVACREMSNHTATLGQVIPLIHILSRKIDLLFDETVGI
DNMLRSLKEALVSRMSATLHDQRYTWATMLDPRYKTSLFTEEEAEQCKQDLIRELDSSSS
TSAEAKSLPPNGCSDDPASHSSSHSNVDDLWSLMPDIRQRTKNEEKPKSSEEAVLEYLEE
DILDQSCDPLDYWNLKKFLWPDLAKVAARYVGCPPSIVPAETLFSTASVNCALNQPRPML
DNIEGLLFLKVNLPLIYFQY
Download sequence
Identical sequences H2M7T4
8090.ENSORLP00000014542 ENSORLP00000014542 ENSORLP00000014542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]