SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014601 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014601
Domain Number 1 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 4 Region: 316-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000636
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000871
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 6 Region: 175-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000339
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 2-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000615
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 289-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000286
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 9 Region: 59-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000293
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014601
Domain Number - Region: 257-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000371
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 230-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000943
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014601   Gene: ENSORLG00000011647   Transcript: ENSORLT00000014602
Sequence length 509
Comment pep:novel chromosome:MEDAKA1:17:17580472:17582106:-1 gene:ENSORLG00000011647 transcript:ENSORLT00000014602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVHKCSECGKCFKHHSVLMEHQRVHSGLHPYNCSVCGRAFRTATLLAGHRLRKCKNAAYL
CIKCGNNFPTSLDKFRHHCPKRGRSYDCQQCGKSFPKSSGLKEHLLTHAQSRLFKCSHCG
LGFSGIGDLKYHQQVDHEKPYKCSRCGKSFISPKSLAKHQQRHEGAGYPRGRLTHNCPLC
GRSFKYRFEFLEHQRFHTAVKPYKCSQCGKAFRTEAHLSGHRKRKCKNAAHICTKCGCQF
RSLHERMRHTCVQLLTKYECSHCGKTFKMAHMLRNHQMSEHQLPYSPNHRFRCRYCDETF
PGISELKYHQRVDHEKPYQCQECGKCFLSEKCLSNHELRHNDERPESCLVCGRGFRNRYD
LKQHMRTHTGERPYQCTHCSQCFSTAGGLRSHTRVHTGEKPHVCPDCGKAFSQMGAMRTH
RLTHTGERPFKCTVCGKGFTMAHKVTVHMRVHTGERPYVCSQCGKAFSDGSVLKQHMLNH
SGVRPYHCQICPKTYTCLNHLRRHLKSHS
Download sequence
Identical sequences H2M7Z0
8090.ENSORLP00000014601 ENSORLP00000014601 ENSORLP00000014601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]