SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014689 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014689
Domain Number 1 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 61-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 280-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 360-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-16
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 19-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000178
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 392-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000618
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 233-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000138
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 10 Region: 443-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000152
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014689   Gene: ENSORLG00000011722   Transcript: ENSORLT00000014690
Sequence length 475
Comment pep:novel chromosome:MEDAKA1:16:16839034:16847705:-1 gene:ENSORLG00000011722 transcript:ENSORLT00000014690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCGKVYNYISKYILRDFVHSSDHPFQCLDCGKSFRWSSRLTHHQRSHNNERPYRCSICPK
AFKGSSALLYHQRSHSGEKPYKCQDCGKAFKRSSLLQVHQSVHTGVRTFLCPYCPLTFKW
SSHYQYHLRQHTGECPYPCDTCPKAFKNSSSLRRHKNVHLGLKPYTCSVCNKSFTQSTNL
RQHMRIHTGERPYICGECGRSFTHSSNLALHKNSHSSLNAGQKEGNCGSCSNTFSTRRQL
EEHQAIHMSRSQFSCSACDRSFPLLSSLLTHQHSHTPEQRPYRCLECGKAFKGSSGLKYH
MRDHTGEKPYRCTECGKSFKRSSLLSIHQRVHTGVRAFQCPHCPLTFKWSSHYQYHLRQH
TGERPYVCKECGKSFKNTSCLRRHSQMHSGLRPHTCSICSKSFSQTSNLKQQHERTHSGE
RPFQCTHCTKSFTHSSNLQLHLRTHSLRKDYKCPYCSKEFVMHSYLQRHIRTHGS
Download sequence
Identical sequences H2M877
ENSORLP00000014689 ENSORLP00000014689 8090.ENSORLP00000014689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]