SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014767 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014767
Domain Number 1 Region: 30-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.57e-17
Family Linker histone H1/H5 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014767   Gene: ENSORLG00000011785   Transcript: ENSORLT00000014768
Sequence length 211
Comment pep:known chromosome:MEDAKA1:14:21902437:21903150:-1 gene:ENSORLG00000011785 transcript:ENSORLT00000014768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEAPAAAPAKAPAKSPKKKKAAARPKKDGPSISKLLVSAVTESKERKGMSLAALKKVL
AGKGVDVTKANKRINTAVTKLVTKGTLSQTKGTGASGSFKLAKETKPAKPEKKVVKKKAP
AKAKKPAAKKTVAAKKPAAKKPAAKKSPKKAPAKKAAAKKVVKKSPKKPAAKKPKAAKKP
AVKKTTAKKPAAKKAKKIFLSYLQVSTPSKK
Download sequence
Identical sequences H2M8F1
8090.ENSORLP00000014767 ENSORLP00000014767 ENSORLP00000014767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]