SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014877 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014877
Domain Number 1 Region: 282-386
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000572
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily SRCR-like 1.18e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 412-512
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 4 Region: 125-227
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014877   Gene: ENSORLG00000011875   Transcript: ENSORLT00000014878
Sequence length 514
Comment pep:novel chromosome:MEDAKA1:14:22133147:22140114:-1 gene:ENSORLG00000011875 transcript:ENSORLT00000014878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVQLVNGRNRCEGRVEVIYNGSWGTVCDDDWDMVDANVVCRQLGCGVAMAVGSSSQFGQG
TGLIVLDNVDCRGSESDLSQCNSLGWGVHNCYHYEDVAVTCRDFLQDRNITHHIMESSPV
GLGDGTIRLVNGKNSCQGRVEIHYQGNWGTVCDDDWVLNNAMVVCQQVGCGSAISAHTNS
YFGYGTGLILLDNVHCQGTEQELSKCKSLGWGKHNCGHHEDAGVTCTVLTTGITTVPPSI
TGNQRVFLETVGTKATEIVPVTESTTTTTTTVSTTAQTKAKPSIRLVNGNSSCQGRVEIL
YKTVWGTVCDDDWDIVNAVVVCRQLGCGPAIEAKSLAFFGYGSGPILLDNVECSGSESDL
SQCFHLGWGQHNCGHHEDAGVICARKLQCSIWIVTEKVTTTTTTTQPSEGMLRLVGGQHR
CEGRVEMYMGSGWGTVCDDAWDLADAQVVCRQVSCGEATAALGEAHFGPGMGRIQLDNLK
CRGAERSLLECSHIEWNVHNCDHSEDAGVTCSLS
Download sequence
Identical sequences H2M8Q6
ENSORLP00000014877 8090.ENSORLP00000014877 ENSORLP00000014877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]