SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014952 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014952
Domain Number 1 Region: 12-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000678
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014952   Gene: ENSORLG00000011936   Transcript: ENSORLT00000014953
Sequence length 218
Comment pep:known chromosome:MEDAKA1:11:21854265:21864405:1 gene:ENSORLG00000011936 transcript:ENSORLT00000014953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIMDGLETPYEEDLEFIQCTVCEKSLKGESLFKIHLTTPAHLKKEHAVVASGQAVRQK
MVPKFTDIIKYLDYLQLDEPIIGLSCLEEVPNPDPQLGPKFMCRLCKHPAILTDMVCHVI
GRKHRQKYVEAKRPDLVTWDYKIQNTQAGKIMRAKAEIIERQDGRGYPQIMKRRGIEGKL
NILRIPPRQRQSKEQSIPHRPTLDVPPLLPEFADFNNR
Download sequence
Identical sequences H2M8X7
8090.ENSORLP00000014952 ENSORLP00000014952 ENSORLP00000014952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]