SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014984 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014984
Domain Number 1 Region: 77-295
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-50
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 300-408
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014984
Domain Number - Region: 425-458
Classification Level Classification E-value
Superfamily FnI-like domain 0.0502
Family Fibronectin type I module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014984   Gene: ENSORLG00000011961   Transcript: ENSORLT00000014985
Sequence length 504
Comment pep:novel chromosome:MEDAKA1:16:16985384:16991109:-1 gene:ENSORLG00000011961 transcript:ENSORLT00000014985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFQSFRKKRSSKYFKAAQLYQQYSEAAQNIEILRQGRTDVLSICEEAPSSPFPNKRRSS
SPRLSISQPGTLWRELPGVRDNNKLEELTENQLRLQEVRFEVVTSEASYCHSLDIVVEHF
VKCKPLQDLLGNQDRNWLFSRLLEVRAISHRFLEKLEERVDSDIMHFTVCDIIAHHCKRF
RTVYVPYLTNQSYQDATYQRLMTENATFKQLVESIEKSAVCQRLPLRSFLVLPFQRITRL
KLLVQNIVKRTNPGTEEAKQAIRAMKLLESIIQQSNDSISQMKSIESLVSLNAKVDFECK
TLPLISQSRRWVREGPVIELMDFACKDAERSVYLHLFNDYLLLSLQKEGGRFTVINHVPV
NELQVENCRIKLHSLQKNLFRLQMSTTSYLLRTDTQSDKLRWISALKRPHDQVDFSAAQG
KQDVFFCSCTNGFIISYHYKCGIFVLKIVSKCCAYWVEGTRLSDFQRGWVLKSHLETISN
SKVKERNLSDAFKLTTATAATVAD
Download sequence
Identical sequences H2M906
ENSORLP00000014984 ENSORLP00000014984 8090.ENSORLP00000014984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]