SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014992 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014992
Domain Number 1 Region: 288-372
Classification Level Classification E-value
Superfamily RING/U-box 1.32e-20
Family RING finger domain, C3HC4 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014992
Domain Number - Region: 374-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0666
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014992   Gene: ENSORLG00000011969   Transcript: ENSORLT00000014993
Sequence length 1070
Comment pep:novel chromosome:MEDAKA1:6:17343305:17347405:1 gene:ENSORLG00000011969 transcript:ENSORLT00000014993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMAERSLEIDGPRSVVPDELHPPHSEYSQWKFKLFRVKSMERAPLPSKTQSEIGATLVIS
APAVSDEETGLGEAPASVMKLCFGGKSKENVEGPGRRVDMKLQEMDTHMNHLRCLCRICG
MALRKVKGPLHEVHGNLEETSKCALRKMGCKLTSWPQVLLNVFKVDVTEDAESIHPLFFC
HRCCMVAIRGGGVCSFTRTQISEWKPHSSHCHLCYPKKLSFQRTGRKRRKVIPRAQSLAK
RSRWDHSDSISLGERKALSQYGERQGPVLRAWKKAGLQREQWVRSITHCQKEHLSTKLIS
EKLPVDFIISLTCLVCDHLLCDPVQSPCGHLFCRSCIMKLTHVLGPHCPACNFSCAPDDL
IPPSKTFLSALHSLLLLCPSDGCDEEVRLDSIKAHCLSHKLENRSNRPTLEFDNYLLANK
GGRPRQHLLSLTRRAQKHRLRDLKTQVKEFADKEEGGDVKSVCLTLFLLALRSSNEHRQA
DELEAMMQGRGFGLNPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRAAEK
ELLPGFHLFEWQPALKNVSTSCNVGIINGLSGWTSSVDDIPAETITRRFRYDVALVAALK
DLEEDIMDGLRESGMEDSTCTSGFSVLIKECCDGMGDVSEKHGGGPAVPEKAVRFSFTIM
SISVQVEDGDKEVTIFTEPKPNSELSCKPLCLMFVDESDHETLTAILGPIVAERDSMKHS
RLILSIGGLQRSFRFHFRGTGYDEKMVREMEGLEASGSTYVCTLCDSSRAEAAQNMVLHS
VTRSHDENLERYEIWRTNPYSESVDELRDRVKGVSAKPFLETQPTLDALHCDIGNATEFY
KIFQDEIGEVYKKVNPSREERRSWRAALDKQLRKNMKLKPIMRMNGNYARKLMTMEAVEV
VCELVPSEERREALRELMKLYLQMKPVWRATCPAKECPDQLCRYSFNSQRFADLLSSTFK
YRYNGKITNYLHKTLAHVPEIIERDGSIGAWASEGNESANKLFRRFRKMNARQSKAFELE
DVLKHHWLYTSKFLQKFMEAHKDSAKAFQATIDPVETLDEDDLSLELPDS
Download sequence
Identical sequences H2M914
ENSORLP00000014992 8090.ENSORLP00000014992 ENSORLP00000014992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]