SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015033 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015033
Domain Number 1 Region: 101-314
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-55
Family DBL homology domain (DH-domain) 0.0000755
Further Details:      
 
Domain Number 2 Region: 326-445
Classification Level Classification E-value
Superfamily PH domain-like 8.41e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015033   Gene: ENSORLG00000012006   Transcript: ENSORLT00000015034
Sequence length 546
Comment pep:known chromosome:MEDAKA1:23:8769549:8774195:1 gene:ENSORLG00000012006 transcript:ENSORLT00000015034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAYDEGGILVPIKRTLQVIDHQNQANKESEEPSNKRVRPLGRVTSLANLISPVKNGAVR
RFGQTIQASFRGDGKSPGAPQKPCGKVPAPTPPKRRNSILWSETLDIHQKGTFSTKEIKR
QEAIFELSRGEQDLIEDLQLARKAYHDPMLKLSIMSEVELTHIFGNLDAYIPLHEELLAQ
LSKATRPDGTVGQIGQIVINWLPRLDAYKNYCSNQLAAKALLDQKKQDPRVQDFLQRCLE
SPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPVDHPDKGSLEEAITIIHGVLSDINV
KKGESECQYYIEKLEYLEERQKDPLMEQCRSLLCHGELRNKSGTKLHVFLFTELLVLTRP
VTRNERQCFQVYRQPIPVHDLVLEDLQDGDVRMGGSFRGAFSNADKAKNIFRVRSQDPSH
SQSHTLQVNDIFQKQQWLNCLRSAISVHRPFSEPSSPSLPPTDACHKRRPSSASAVIHLE
EPDENCLQPATSRSAPSSPCSSSTPSPTSASPSSRSSSSSLLSMSHKSKKDKKLICSLGK
RKETMV
Download sequence
Identical sequences H2M955
XP_004083012.1.28442 8090.ENSORLP00000015033 ENSORLP00000015033 ENSORLP00000015033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]