SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015054 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015054
Domain Number 1 Region: 564-753
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-51
Family DBL homology domain (DH-domain) 0.0000000274
Further Details:      
 
Domain Number 2 Region: 758-896
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-38
Family Pleckstrin-homology domain (PH domain) 0.000000452
Further Details:      
 
Domain Number 3 Region: 261-398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000102
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 4 Region: 1045-1095
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000681
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 86-169
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000366
Family CRAL/TRIO domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015054
Domain Number - Region: 355-496
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000688
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015054   Gene: ENSORLG00000012020   Transcript: ENSORLT00000015055
Sequence length 1115
Comment pep:novel chromosome:MEDAKA1:21:11254338:11279156:-1 gene:ENSORLG00000012020 transcript:ENSORLT00000015055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEIMQLDSSPLRAADITTDLKKQFAFLSGGRGDNGSPVIVFPEFPAFSEITDREFHNVLS
YLTSVPSLSSTDVGFILVIDRRQDRWAAVKGTLLRIAGSFPGNLQLVLVLRPTTLLQRTL
SDILFKFNKDDFKMKVPVIMLSSLTELHSYIDRSQLTQELGGTQEYCHEKWISHRTAIEG
FALMVKRTAQALQSFGTELAETELPNEIQATTILLSTHTNKRDKMKEDLLVALGQGSRLL
ESINEPIMHNPDHNMNQDELENLATVQRLLSQLDETERAFDEFWLRHQTKLQQCLQLRHF
EHNYREVRALLDQTSEKLTSFSEVGISPAHADHIFTELTTFEERVCEVLDKALALSREGD
ELIQNSHYDEDSIQPKCCELRALSESTSSSLRAKKDHLLKAIELHHRLDRTSKWVDDGIY
LLASQPVDKCQSHEGAEVALQELERYLDNAGCSQLTDLSSIWTEYEGVLNHQLREQVEKV
YQKQTSMQEMFDKRTVSLKKLAAKQLRPVQPVAPRPEAFIKSPLNSPAHRVQQEINSSDS
DNSCGKGQQQNEDGNSRHASLSEEEENLAVLRRHVMNELLETERVYVEELLCVLQGYASE
MDNPGMSHLIPPSLNNKKEVLFGNMPEIYHFHKRTFLRELEQYTDCPELVGRCFLQRMTD
LQIYEKYCHNKPRSESLWRQCSDCAFFHECQKKLEHKLGLDSYLLKPVQRITKYQLLLKE
MLKYSRGREGADDLQEALTSIVGILKAVNDSMHLIAITGYEGNLSELGKLLMQGSFSVWT
EHKKGHAKVKDLARFKPMQRHIFLHEKALLFCKKREENGEGYEKAPSYSFKQSLSMSAVG
ITENAKGDNKKFEIWCNSREEVYIVQAPTADMKTTWVNEIRKVLTTQLEACREASQQRAP
DPVIQAPPVHSVTVCLSSNVRNKVTQLPTLLSPLILLKVWCASGMTRFPSGSDGAVTSPT
SDRAAVAKKRFTLQGFSNLKAQKGSPTSPDHKSKRQSDPTPFGYKGWNKPTLSLDASGEN
DGYSSAEEPLNSDPEDENTKKLCAGKYTVLVDYEKGGAEELSVRSGDSVELVKEGDDGQW
FVRNLNSSSEGWIAAANLLTLIEKSKSCQSLTSSG
Download sequence
Identical sequences H2M972
ENSORLP00000015054 ENSORLP00000015054 8090.ENSORLP00000015054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]