SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015118 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015118
Domain Number 1 Region: 793-843
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 143-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000106
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 199-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000711
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 242-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000113
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 833-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000142
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015118
Domain Number - Region: 76-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000756
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015118   Gene: ENSORLG00000012077   Transcript: ENSORLT00000015119
Sequence length 1135
Comment pep:novel chromosome:MEDAKA1:13:22534774:22560725:-1 gene:ENSORLG00000012077 transcript:ENSORLT00000015119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QILDGSGHVKFCVDASKPDTGSWLKHIQFAPTATQHNLTACQVDDQIFYKVTREIFPGEE
LLLFMKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGGPPSSFLNSGL
TGDLRPYSSSHGLHECKECDQVFPDVQSLEAHMLSHSEEREYKCDQCPKAFNWKSNLIRH
QMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQHKH
IHSSVKPFMCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFTAGALFAQGMPLPGTTGLDKAALAMGHSSAGLADYFGASRHHSGLTFPAAPAFPF
SFPGLFPSGLYHRPPLVPATTSPIRQPPHAPVAGPGTEVSKSPLLPPSPGALESRELLKA
LGKDCSPEKEKLDSELHNQGSSSSTKQRNKQSDHSESSDLDDVSTPSGSELESTSGSELE
SDLDSERERGAARENGKGPKRKASEGEPKSHGLMDSSAAIDFPGPSLIPSSLDEHTAVTG
AVNDSIKAIASIAEKYFGSTGLAGLQDKKAGPLPYPSMFPLPFFPAFSPPVYPFPDRDAR
STNLKADPQSPGDECKKAQGKSSSESPFDLTTKRKEETLASFASSKPEPSHPSGQDQPLD
LSLGPRGHGRKLKEEDVKKNPTYKDEKRAVEIPKPNTSLQHARPTPFFMDPIYSRVEKRR
MSDPFETLKDKYMRPTPGFLFHPQMTAIENMAEKLETFNSLKPESGDLLRTVPSMFDFRA
PPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNL
QRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSDGKVCFFIKNHFSGTAMS
SPQSELDSSSAILDDKEDSYFNEIRNFISSTGQNQASPDPSEEGWDVCVWGGGGGCTRLY
NHVERDLEDEEVEDLGADEDEEAEEPGDGPDKSDAKVLPSNLDDDITQDEMDFSGANNLK
TSCNTSPMRHEEEQEQSSYSALDHIRRFSDMHKLEESELSDKDGDEEDGSFGSASLTEMV
KQPLFRKSKSQAYAMMLSLAEKDSLHSAPHAPASMWHSLARAAAESSAIQSLSHV
Download sequence
Identical sequences H2M9D5
ENSORLP00000015118 ENSORLP00000015118 8090.ENSORLP00000015118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]