SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015187 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015187
Domain Number 1 Region: 169-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000145
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015187   Gene: ENSORLG00000012137   Transcript: ENSORLT00000015188
Sequence length 290
Comment pep:novel chromosome:MEDAKA1:17:17942799:17944526:1 gene:ENSORLG00000012137 transcript:ENSORLT00000015188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLNDFLCSKPNLEDFQSAHSLGDPFNYTCANPNSNLTIDQDKNDISTLESNSVSPRPQS
PEPVTEEMNTSIQPATSKKDPADVTDEDIDITTSKKKADLSAAEVKSEILRSDVSVRETR
QSFAFSSYEREDQAEDIKRRRTVSTKNLESSVPMSLAPTLPSPISRPEKKTYCCAECGKE
YASRSGLKGHMKHHGLVTKTSRPKARSSRASSNQPPPSSSATTLNIPATRSSAGFWNQYQ
AFLNTPSEPADDPKVGIQDENESTQLSKPTLPSGMDPRVSEEDGEVSPGV
Download sequence
Identical sequences H2M9J8
8090.ENSORLP00000015187 ENSORLP00000015187 ENSORLP00000015187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]