SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015223 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015223
Domain Number 1 Region: 237-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000873
Family HkH motif-containing C2H2 finger 0.052
Further Details:      
 
Domain Number 2 Region: 170-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000232
Family HkH motif-containing C2H2 finger 0.074
Further Details:      
 
Domain Number 3 Region: 67-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000394
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015223   Gene: ENSORLG00000012168   Transcript: ENSORLT00000015224
Sequence length 377
Comment pep:novel chromosome:MEDAKA1:11:22019176:22033260:1 gene:ENSORLG00000012168 transcript:ENSORLT00000015224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAVMYFGHMCHGSLPAPARPVPGRTQPSPELKALLPFHLLPGFHDMDRINKSLSSSGLG
LSSPLRRKVSSCSACRLRFNSVAQASAHYSGTRHAKRMKALDAPDSKKKTQLSESSVKSG
IYNPKTKSPNPSSQSTPLSSCPFEGTSDQSLPLSPSTSENHGHKDAEADAPDGETEEEKA
LRLLYCSLCKVAVNSASQLQAHKSGTKHKTMMEARNGDGAIKSFPRSGVKAKMSAPPESS
TGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPAKPKFSPYSSTQRHQSLQAI
RLALGKHHDVSKPLAPCLLQRQISVAAAMASLPTFPLQPATNSSPALFPSQALPQALLHP
ASGPICPTHTSVLFSPF
Download sequence
Identical sequences H2M9N2
ENSORLP00000015223 8090.ENSORLP00000015223 ENSORLP00000015223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]