SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015289 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015289
Domain Number 1 Region: 441-477,545-744
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.58e-76
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000638
Further Details:      
 
Domain Number 2 Region: 52-137
Classification Level Classification E-value
Superfamily BRCT domain 5.63e-21
Family DNA ligase 0.049
Further Details:      
 
Domain Number 3 Region: 749-862
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 2.55e-16
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015289   Gene: ENSORLG00000012211   Transcript: ENSORLT00000015290
Sequence length 1276
Comment pep:novel chromosome:MEDAKA1:21:11548478:11563126:1 gene:ENSORLG00000012211 transcript:ENSORLT00000015290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDGWMRKRASAGDDNGWAERGGYMAAKVSKLDEQFRLDAPREKQKEGACSGIFRGVAI
YVNGYTEPSADELRRLMMLHGGQFHVYYSRSKTTHIIANNLPNCKIQDLKGEKVIRPEWI
TDSIKAGHLLPHLKYQLYAKQKSTLFPGITLHQTLEVAGTSQSSLQPNVRQKLHLPQQKI
GLSVPHTGPSLLSCRNNHIPPSSCSSPQPTQHSIGHSIVGQIITDSKHRGPLQSHPPQNL
NHTKPPHKSTHRKEEEKIAIRNGILPTSSDVMSHSKTNKMQESDPYEFPLSPPKQSQMSP
VVLDQSSTEGASGCPHTPPTNHDTAKSHSLLRPNGSHHNAFSCNPALSSPAGVKTKLNLH
SDPSSKSSVQLLEQTGSLISEFYSHSRLHQISTWRIGFSEYINELHHKKKESGSISYPGK
DRLRKAAAQRPSDSRASGSSAPVSVKSCIFHVDMDCFFVSVGIRHRPDLKGKPVAVTSNR
GHGRVPTRPGANPQVEQQYYQRKHAHPQPGIRIPKKEGDLLHTSPSQDSPDSYANGVNLD
SAALSMAEIASCSYEARQAGVRNGMFFGKAKQLCPSLQSVPYDFEAYKEVAINMYEILAS
YTRDIEALSCDEALIDGSALLAELGISPDDLAQAIRADIKEKTGCSASVGMGSNILLARL
ATRKAKPNGQYFLKSEEVDDFIRDLPVTRLPGVGHVMGKKLATLGVTTCGDLQQVSLSQL
QRMFGPRTGQTLFRFCRGLDDRPVRCEKERKSVSAEMNYNIRFTKVEEAESFLSNLSMEV
QKRLREAGLRGRRVTLKVMVRKVGAPLESAKYGGHGICDNLARTVMLTQPTDSGQLIASA
VIKLLHAMQLQVQDLRGIGIQVQLLEGNRHLPPDGRGPRSCSIKEMLTIRSNKNTLKDKQ
NLKNVADYCKEQSTPSASTSSLISSPAEPVPGTSKEQPTCRKTPKHSRTRLSITIEVPSP
SQVDRSVLEALPPELREQVEQSWTKRDGIPNKCHSPALQQSSPHPRQASPPRPALSSPPA
GTLVLQIPNQPNTPGIVLELPNFSQVDPDVFAALPKELQEELKSAYNRAANVQAQLKTGL
SAVEQKNPLLQLKQPAVGTGIGRVKRRYKRKNAVSPLKKGTSPMKRQQTNSPVKPIAAAG
KSREPINIPKVSLAVMENENNPSTSNLDLAEPAVEAVSSPVPMLAGAFDLTDIRTLLREW
VTTITEPMEEDILQVVKYCTELIEDKDLEKLDLIIKYMKRLMQQSVESVWSMAFDFILDN
VQVILQQAYGSILKIT
Download sequence
Identical sequences H2M9U6
8090.ENSORLP00000015289 ENSORLP00000015289 ENSORLP00000015289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]