SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015314 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015314
Domain Number 1 Region: 234-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-21
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015314   Gene: ENSORLG00000012237   Transcript: ENSORLT00000015315
Sequence length 316
Comment pep:novel chromosome:MEDAKA1:5:24713836:24719609:-1 gene:ENSORLG00000012237 transcript:ENSORLT00000015315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPEFAFPPSSPFSPTLEEIEEFLREKMEPVKEEEELLALKAEASPESCSFEGSLSSSGPP
AASKESEGGPGIKQENSPGRAQPSPPAHPYPSPPALTPPMLLGSPLVLQLQPIPVAPPQA
PSGSPQGAQNGIWLTHLVMGLQGAAAQNLTLLAPQVSSTQTATLLSISNGDNKSGDQKYV
KIAPLPISTRTVEITAVTGVEGQSLLKAVAPRVNKVLPTERVHKCSHPGCGKMYTKSSHL
KAHFRRHTGEKPYTCSWPECGWRFSRSDELSRHRRSHSGIKPYECSLCEKKFARSDHLSK
HTKVHRSSRSSRIIRA
Download sequence
Identical sequences H2M9W9
8090.ENSORLP00000015314 ENSORLP00000015314 ENSORLP00000015314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]