SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015348 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015348
Domain Number 1 Region: 2-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-45
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 228-319
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000144
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015348   Gene: ENSORLG00000012267   Transcript: ENSORLT00000015349
Sequence length 367
Comment pep:novel chromosome:MEDAKA1:16:17231301:17235193:1 gene:ENSORLG00000012267 transcript:ENSORLT00000015349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCQTMTKMQRHQQEALWELISTELIYINKLKIIKDLVIAALLNLHQRGFLQEVSPDQLFY
NLPSILQAHQLFWQEVVYPMVQEVRQTGKPFDPMGLEEGCLQFHNRFLVYREYCWEEENS
LDFTRKQMESNPHFQTFIQWVESHPQGERMRLGDMQAKPHQRITKYPLLLKAVLKHTVEP
PVQLALIGMLSSVNIFLESINDYMQKKDDEQALYISARRVEGYEVEGITEEIDKYVQEIC
KFNLECPIRGVNPEVVRKLLLEENLKVRVRKDQKLEVVALLFSDVILLTKIQKRGEGLKV
VRPPLALDRIECIALKDGSEFQSLPPRKFISSGGSGRAAECDECPHFCRRHLTKLLQVGL
HHQSGKG
Download sequence
Identical sequences H2MA02
ENSORLP00000015348 ENSORLP00000015348 8090.ENSORLP00000015348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]