SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015463 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015463
Domain Number 1 Region: 440-714
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.75e-67
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 31-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-31
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 3 Region: 194-308
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-21
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 4 Region: 312-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 5 Region: 379-451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000653
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 6 Region: 143-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000678
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015463   Gene: ENSORLG00000012352   Transcript: ENSORLT00000015464
Sequence length 715
Comment pep:novel chromosome:MEDAKA1:16:17266443:17272930:-1 gene:ENSORLG00000012352 transcript:ENSORLT00000015464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INHCPPATIMRRFLLYVLVCECLPLSDSDTVMHGELHSPQYPEPYPPNALEQWDLTVPEG
FQIRLTFTHLDIEASDGCYYDSLTVLHNGKLLWKFCGNENSGDGNHPGHQPILSPGNSLT
LIFQSDDSNPERHQNVGFFAHFQAIVDVDECSAPETGNGPLCSQICLNTLGSYLCACHHG
YELRSDKSTCVLTCGDGIFDEPEGHLSSPGYPNLSPYSLSCQYVISVKNGFTVSLNFSDI
FHIESVDSENGPHCLHHWLQVTLPNKEPVKLCGKKSPGLIDTNSSSVTLEYHTDNEGMSK
GWSLDYSTGRMKCPMPGSVTRGRVTPSMTEYFYRDHIYVRCDQGYKLMMNTQEIKTFSTV
CQSNGQWHLPLPECHIIDCGDPEPLLNGGVTFLSGSQNQYLSLVQYHCNEPFYSLEGDQN
VTFTCEADRQWRSNDLAVTKPTCLPVCGQPTQEIRDFLRIFGGKDAPQNTIPWQVLLTVG
SGRGGGIIIADKWIMTAAHVLAHKGQQVSKDLMYVGGTEVGAMINSPLYAESVHVHPGYD
SVDDLSYNNDIALIKLGNPLTFRAAVMPVCLPAKDSSYTTGKIGHSPRFFPFFRLVSGFG
LVNDNGSRILTNRMKYVQLPLVDRKKCNDSFNLLKERKHKVPHLTNNMFCAGTPEGGKDA
CQGDSGSPFTLTENKQFWVAGIVSWGVDCGLAGAYGVYTKVVEYLDWINRTMQEN
Download sequence
Identical sequences H2MAB2
8090.ENSORLP00000015463 ENSORLP00000015463 ENSORLP00000015463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]