SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015482 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015482
Domain Number 1 Region: 418-678
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-65
Family Eukaryotic proteases 0.0000886
Further Details:      
 
Domain Number 2 Region: 176-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 3 Region: 18-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-19
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 4 Region: 358-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000181
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 294-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000117
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 6 Region: 128-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000621
Family EGF-type module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015482   Gene: ENSORLG00000012367   Transcript: ENSORLT00000015483
Sequence length 686
Comment pep:novel chromosome:MEDAKA1:16:17275039:17280563:-1 gene:ENSORLG00000012367 transcript:ENSORLT00000015483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWALNFLLLFLCYSASAMLLGWVESPGYPNGYPPHEGLNWSRCAPKGHILSLKLIHLDLE
DSQHCENDALKVYSDEDQISILCGTMTFEELESTVNPFLISPPGGCLKVLFQADYSNPKR
HHGFRGFYTIHDFDECDDDLINKCTQFCHNFVGGYRCSCHHGYQLAEDKHTCNVSCSKDL
SGRNRGEISTPSWPDSYAENANCQYTLSVQPHHQLVLRFSHAFDVEQGPDGQCKDALRIV
TQTETLGPFCGNKPPPSLISTHSNHVQIYFTSDGSGNNKGFKLHFGTMEKVCHPGVIAYS
KMTPHKQEYKSGDTVTVICDTGYVVNSHGALALSAQFETTCQSVGEWYPSYTCELADCGL
PQIESNSILELMDLPAQKTQYNAEVQFKCSSDYYNLQGHDKYTCNATGHWVTPDGKADMP
KCTEVCGVNSNPIIARILGGESAVLGNIPWQLLIKYPNRGGASLINDQWAVTAAHVVDGC
DETMIQIFGGLVDGKKSDNTNILTCERIIIHPGYEKGISHDTRTNFDNDIALIKFKSRVN
LDPNLRPICLPDANSVVQENEVGTVSGWGTTEKSRKSRSLMYAHISAYPLSNCRNTPDLP
GVGTITFTENMFCAGAVGKDSCSGDSGGPFILPMLSSSRGPYHLAGIVSWGAPCRDGGNK
GYYTKVQKYIDWIKNTIEKRNGHSVD
Download sequence
Identical sequences H2MAD0
ENSORLP00000015482 8090.ENSORLP00000015482 ENSORLP00000015482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]