SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015513 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015513
Domain Number 1 Region: 448-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.86e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 141-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000272
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 10-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000376
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 258-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000003
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 55-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000632
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 9 Region: 197-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000032
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015513   Gene: ENSORLG00000012390   Transcript: ENSORLT00000015514
Sequence length 504
Comment pep:known chromosome:MEDAKA1:23:10364893:10371798:-1 gene:ENSORLG00000012390 transcript:ENSORLT00000015514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HECPDCNKRFKFASSLLAHSVIHSGVRPHHCSDCGRSFSFRQSLDRHRHTHRSGRTYDCA
VCGETFRSLSARTEHKHVHMQDRAYTCSQCNRRFSLELSLARHLKTHLDEKAGNCSCFFL
KDVIKACLSTYNEVSTDEEGHFNCPDCEKSFRFLSLLKAHRRVHTGEQPFSCSQCGWRFS
FKQSLDRHEQTHKSGHKYTCLICGDLCKSAADLTEHQSGHMEDGEYLCSECGQTFSWRSA
LVRHLRTHGMNADMVEDPYKCPYCSLSFSCASYLKRHIQTHQEERVHACSCGKSFTYRAA
LTAHQRTHQKERPHTCTQCGKGFLYKGGLLSHMKIHSEEMPFMCSFCGKSFKRERNMKKH
ERCHTRENVFRCSQCDKSFVYKATLIRHELTHSGERPYLCSDCGKGFFSHAELLKHERFH
TGHKPFQCSYCDKKFTQSCYLTIHLRYHTGARPYTCAECDKSFLSANRLKRHQRTHTGEK
PYPCMECGKGFKQSYHLKMHQRTH
Download sequence
Identical sequences H2MAG1
ENSORLP00000015513 ENSORLP00000015513 8090.ENSORLP00000015513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]