SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015532 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015532
Domain Number 1 Region: 351-634
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.88e-45
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015532
Domain Number - Region: 632-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00357
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 666-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0283
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015532   Gene: ENSORLG00000012412   Transcript: ENSORLT00000015533
Sequence length 702
Comment pep:novel chromosome:MEDAKA1:24:5976924:5981541:-1 gene:ENSORLG00000012412 transcript:ENSORLT00000015533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQDQMDHLLAVSLKEDELSRSLQDVDTSLIQARNAVQAAYAEVQRLLLLKQQFTVEVNSL
RAKRIEILQEMQEGYSGASNAVERATTSSAVAASSSQQPFTAAPAPFSTQPFSNPLVLSA
VPLNQEVSHVATTGQASLLPTALSCTADVPQVTLTPPVPLFPPDLLPPLLLRPPLVPPLT
DATSARRDLTESGKAASEASAQQREHDTGKGINKSQSVGTGLVEKVGNETAADKSVPERQ
KKADRAEDEGNESDASVEMVSSSKVEVIEVDESECENSVETNSKDPPESVNVEVSSTSTQ
TSQQNQTDGQNKSQTHSQIHVTFNYFFFLSLTPNSVEDQEPSVGSFSSHAGPVHGLQIHD
GILYTCSADNTARAYNLVTRECQAVFQGHTNKVNCLLVSIVPYLPARLYTGSSDQTIRCY
SLKSKRCLQQISLPDRVLCLHVAWNILYAGLASGSVFSYDLKTLKELDVFECHGPRGVSC
LGTAQEGARRLLLVGSYDSTISVRDAKSGLLLRSLDGHTKTVLCMKVVNDLVFSGSSDTS
VHAHNIHTGELVRIYKGHGHAVTSIVILGKVMVTASLDKLVRVYELQSHDRLQVYGGHSD
MVVCMAVHKSLIYTGCYDGTIQAVKLNLMKNYRCWWQNCSLIFGMAEHLLQHLVGDHSHP
NLQTVKCRWKGCNAFFSTQQSVKKELPEHMQSHIENDSMQQP
Download sequence
Identical sequences H2MAH8
ENSORLP00000015532 ENSORLP00000015532 8090.ENSORLP00000015532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]