SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015558 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015558
Domain Number 1 Region: 339-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000223
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015558   Gene: ENSORLG00000012424   Transcript: ENSORLT00000015559
Sequence length 454
Comment pep:known chromosome:MEDAKA1:6:19060085:19085706:1 gene:ENSORLG00000012424 transcript:ENSORLT00000015559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDVRDLNSLLPPVPAGPSPGCPALPVSTAPQWAPVLDFHPAASPYSSLAAPHSFIKQE
PSWGAASDPHHLDSDPHCGLSAFTVHFSGQFTGTGACRYGAAFGAPPPPPTAPSQPPPVA
APHHHQPPSRMFSNPPYLTNCMDTQPPARNQTGYSTVGFDGAGNYGHTPTHHSSQFSGHS
FKHEDALAQQNTMGEQQYPVPPPVYGCHTPSDSCTSSQALLLRNPYNSGENLYQMTSQLE
CVAWNPVNTLASTIKSNSLISSSTQEWVESSSHAAGYDSDPSTPMVYSCSTQYRIHTHGV
FRGIQDVRRVPSIAPAIVRSESSEKRPFMCGYPGCNKRYFKLSHLQMHSRKHTGEKPYQC
EFTDCGRRFSRSDQLKRHQRRHTGVKPFECETCQRKFSRSDHLKTHTRTHTGKTSEKPFN
CRWPNCQKKFARSDELVRHHNMHQRNLTKLQLSI
Download sequence
Identical sequences H2MAJ9
8090.ENSORLP00000015554 ENSORLP00000015554 ENSORLP00000015558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]