SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015646 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015646
Domain Number 1 Region: 720-768
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000554
Family Myb/SANT domain 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015646
Domain Number - Region: 852-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00333
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015646   Gene: ENSORLG00000012495   Transcript: ENSORLT00000015647
Sequence length 947
Comment pep:novel chromosome:MEDAKA1:24:6004330:6013917:1 gene:ENSORLG00000012495 transcript:ENSORLT00000015647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQLGEHYRGTEKVLHSKHRTVAMKKAVQHPGEAHYGMGPPSLKTSHSDGAGGSNVGALPH
YQQAPSVKWMQDSVQGAGWSQEASVQGWGQNFAPYIGGVNVRGQMGFHKGTHDGVSLQIG
AENQLPAPVEVYRDATQAQSQGRGLEWEQHAAAAMHQAQLQAYHHKGMELQSQPPVPSHT
LQGQVLQPFQASFGPNKQQFPSEYYPVFPGNKAVQSLVYGEQPKTQQQLLHQVPQQEPTQ
PPVQSKQQQTQNFGAYPHPELQLSDSVPVKEEPQSVLQQPETPTCDASPAPDQYPEDPTQ
TPDAAQAAPRRSRRLSREGQSPLGPPPANLWPKEPPPSLNGAPGVPAAKGGGGASQVATG
GVIQNNRRRRRASKEINLETLAQKASEMESLPAKTRFGSKQEDGASGKQPPVVPLVIPVS
VPVPRSQMDPQGGWAQASLSQREWSAGQSDRKPSVIVARRRSRRNSVTESFSQDGENDSG
ADEDGKSKFKRRPRPEPLIIPPPKASSFIPPSLYPSITSYQSNLRSPVRLPENLHAPPPY
TPPPILSPVRGGSGLYFSAFLTNMASNQILPPPVTPKSATRSLLRTVCSDSTPPVLPIVT
DAAPVSLEPRINIGPQYQAEIPDLQNPDFAQNDQHQADLLWLPLEDSNHKNANQHTTVEH
FMNLACSSVLEGGGTNQELVLHCLHESGGNLLETLERLMLQEPIFPVDHHLKNYHYSGSD
RWTREEKRYFNKGISAYRKDFFLVQTLVQTKTVAQCVEFYYTYKKQVKIGRNSILTFGPP
DSPSETQEERQDDGQKEKPYESHERPVDRSLQVHDYVSINTTPTAGEDPLNRAEPTAKKA
KPQPKPPQDPNAVFPCKKCGRVFSKVKSRSAHMKSHAEQEKKAAALRQKQEEEQAAIQAQ
ARKAAASAAAAAAAHHGGNGNGWMQQAEISSQDDSSEAEDDNDADWQ
Download sequence
Identical sequences H2MAT5
ENSORLP00000015646 8090.ENSORLP00000015646 ENSORLP00000015646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]