SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015697 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015697
Domain Number 1 Region: 357-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000682
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 390-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000069
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015697   Gene: ENSORLG00000012539   Transcript: ENSORLT00000015698
Sequence length 426
Comment pep:known chromosome:MEDAKA1:17:18942285:18943777:-1 gene:ENSORLG00000012539 transcript:ENSORLT00000015698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAFPTLKAMDNECRSWNAAAVCADNPCIEVEFSIVQSPALPPREEDELGKFLDLEFILSN
TVGSSRETGRLSPAQQLQSAYSLPESPESCSGSSLPDCSDRPSPRLPTQDYCSSVNFTDS
NPVCSLMAELLSPEMIAYSSESSQDKAGGETRDGREYTELRALNRAPIPPQVAASPSQLG
YKIKTEPGVQSCMVAAGGGSYLEQVYDKHQMRSAHPAAFTHHQAAAPGALQGFGGLPPQQ
PALHRRTDCHLAPINSTLHSAHQPSQYLNAPYPAQYRGLSQFQGQYTVHGQPMHENHHSM
AMQGMILTPPSSPSLMELYAHDEGCVKQKRGRRSWTRKRAATHNCEFPGCGKTYTKSSHL
KAHMRTHTGEKPYHCNWEGCGWKFARSDELTRHFRKHTGHRPFQCHLCERAFSRSDHLAL
HMKRHM
Download sequence
Identical sequences H2MAY4
ENSORLP00000015697 ENSORLP00000015697 8090.ENSORLP00000015697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]