SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015756 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015756
Domain Number 1 Region: 50-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 89-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000282
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015756   Gene: ENSORLG00000012581   Transcript: ENSORLT00000015757
Sequence length 138
Comment pep:novel chromosome:MEDAKA1:16:17385465:17385878:-1 gene:ENSORLG00000012581 transcript:ENSORLT00000015757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDQDGEPLEALESDIKLISSPSGLKPSLQEQALHVHPFLNISDGEESKGKPYSCPVCKKR
FSNCSHLSAHIRTHTGERPYRCEICRKRFITTSALNRHQTIHTEGKQFICTYCGKSFKWM
ESLGRHIRSAHKGDNTAV
Download sequence
Identical sequences H2MB39
ENSORLP00000015756 ENSORLP00000015756 8090.ENSORLP00000015756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]