SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016076 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016076
Domain Number 1 Region: 351-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.43e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 309-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-17
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 395-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000233
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 223-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000238
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016076   Gene: ENSORLG00000012835   Transcript: ENSORLT00000016077
Sequence length 574
Comment pep:novel chromosome:MEDAKA1:16:17559107:17566357:1 gene:ENSORLG00000012835 transcript:ENSORLT00000016077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSHFNSSYFWSPVPTVQGQIENAMFLNKMKEQQEKNTPFSPPSSHYQTALLTIPTPGP
KTDGGGQVGNAGHLNPPHSTQNITVLPVPSTGIMTAGTLRQMKSVLISVSPRAAGLVITT
PQGTLVSPTSSQSFVSGHPAATMIVSALHSPARTVQTVREVEQKIFHLVVDKKEGEGASH
VVVMPAPSKRGRKKKTTVPRVPHHTGDPYELSNEEEEHGPKDGTKTYRCRMCAATFFNKS
DMQIHSKSHTEAKPHKCPHCAKSFANSSYLAQHIRIHSGAKPYTCSYCQKSFRQLSHLQQ
HTRFHLKNHTESKPHKCPHCTKSFANSSYLAQHIRIHTGVKPYTCSYCQKSFRQLSHLQQ
HSRIHTGDRPYKCTHPGCEKSFTQLSNLQSHRRQHNKDKPYKCMHCNKGYVDAGSLEAHM
TTHTVKHARIYSCGLCHRSYTSETYLVKHMEKHMEKHNPDQLTAPVAVAQQSAQQNQRQS
HGQTGTQSQVESADGGPRQPGGAVSRAAGEGQQAQNQSGYAQTELTCPFDLNQYKTVSAS
DIQYKPVSVADITSHKDLCLTVSASTIQVEHLNS
Download sequence
Identical sequences H2MBZ8
8090.ENSORLP00000016076 ENSORLP00000016076 ENSORLP00000016076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]