SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016227 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016227
Domain Number 1 Region: 547-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 510-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 588-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000147
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 61-170
Classification Level Classification E-value
Superfamily SET domain 0.000000343
Family Histone lysine methyltransferases 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016227   Gene: ENSORLG00000012948   Transcript: ENSORLT00000016228
Sequence length 680
Comment pep:novel chromosome:MEDAKA1:24:6519778:6524577:1 gene:ENSORLG00000012948 transcript:ENSORLT00000016228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PENQDLDMTLWSEKDFEEKYIYTVKDHRFEEESENSCKTRAERSLPRNLALKRCHNPPEV
LGVISKELIPKGTRFGPFVGERYTNDTLPKDANRKYFWRVFVGRNLHHILDGLNEERSNW
MRYVSPARTVEEQNLVACQSGLDIYFFSIKPLLPSQELKVWYCPEFAQRCHYLPLEQPMV
NKNGNLSLLFVCLTEQSNAHEKTSGKRGHSVSEILREEPAKSRLSLPGCLDDSSSRIYVP
AVLPLCPSVLYPVQPFSESIYNHGYAPLPPLPPCSPPTAKRQALSISLPTSLHFALQPSQ
AYRESYVPDHITSAFRHGSFPLPHYSLGLLPHSYSLYSDRLKPPFAVSSNPSPFDSHAMF
LNPLTSDCKGLPQVPSSSKSNLKLTIEQKDSKDLTSQRTTYLRSSSDDLRVLKSSPRSNA
GMDHSVPSKAGISPINTELCGSLSSFAHGGCSPPAGMGAPSSCLPSKPTSAIQSITEDAL
DLRKTKQEGQIIGYKTLSYPLTRENGKIRYECNICKKIFGQLSNLKVHLRVHSGERPFKC
QTCNKNFTQLAHLQKHYLVHTGEKPHECKVCHKRFSSTSNLKTHLRLHSGERPYQCKLCP
ARFTQFIHLKLHKRLHTGERLHRCPHCSCAFLHYCSLQVHLQGFCPLSPSASCRYSPEEL
HRFNCEIERFDSSEAAEQLE
Download sequence
Identical sequences H2MCE2
ENSORLP00000016227 8090.ENSORLP00000016227 ENSORLP00000016227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]